HMX2,NKX5-2
  • HMX2,NKX5-2

Anti-HMX2 Antibody 25ul

Ref: AN-HPA043379-25ul
Anti-HMX2

Información del producto

Polyclonal Antibody against Human HMX2, Gene description: H6 family homeobox 2, Alternative Gene Names: NKX5-2, Validated applications: IHC, WB, Uniprot ID: A2RU54, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HMX2
Gene Description H6 family homeobox 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence ELEAANMAHASAQTLVSMPLVFRDSSLLRVPVPRSLAFPAPLYYPGSNLSALPLYNLYNKLDY
Immunogen ELEAANMAHASAQTLVSMPLVFRDSSLLRVPVPRSLAFPAPLYYPGSNLSALPLYNLYNKLDY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NKX5-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A2RU54
HTS Code 3002150000
Gene ID 3167
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HMX2 Antibody 25ul

Anti-HMX2 Antibody 25ul