SREBF1,bHLHd1
  • SREBF1,bHLHd1

Anti-SREBF1 Antibody 25ul

Ref: AN-HPA043343-25ul
Anti-SREBF1

Información del producto

Polyclonal Antibody against Human SREBF1, Gene description: sterol regulatory element binding transcription factor 1, Alternative Gene Names: bHLHd1, SREBP-1c, SREBP1, Validated applications: IHC, Uniprot ID: P36956, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SREBF1
Gene Description sterol regulatory element binding transcription factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAI
Immunogen SLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHd1, SREBP-1c, SREBP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P36956
HTS Code 3002150000
Gene ID 6720
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SREBF1 Antibody 25ul

Anti-SREBF1 Antibody 25ul