ZNF587,FLJ14710
  • ZNF587,FLJ14710

Anti-ZNF587 Antibody 25ul

Ref: AN-HPA043288-25ul
Anti-ZNF587

Información del producto

Polyclonal Antibody against Human ZNF587, Gene description: zinc finger protein 587, Alternative Gene Names: FLJ14710, FLJ20813, UBF-fl, ZF6, Validated applications: IHC, Uniprot ID: Q96SQ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF587
Gene Description zinc finger protein 587
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KDVLPSSGLCQEEAAVEKTDSETMHGPPFQEG
Immunogen KDVLPSSGLCQEEAAVEKTDSETMHGPPFQEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14710, FLJ20813, UBF-fl, ZF6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96SQ5
HTS Code 3002150000
Gene ID 84914
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF587 Antibody 25ul

Anti-ZNF587 Antibody 25ul