HSPA1L,HSP70-HOM
  • HSPA1L,HSP70-HOM

Anti-HSPA1L Antibody 100ul

Ref: AN-HPA043285-100ul
Anti-HSPA1L

Información del producto

Polyclonal Antibody against Human HSPA1L, Gene description: heat shock 70kDa protein 1-like, Alternative Gene Names: HSP70-HOM, hum70t, Validated applications: IHC, WB, Uniprot ID: P34931, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HSPA1L
Gene Description heat shock 70kDa protein 1-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence KLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Immunogen KLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSP70-HOM, hum70t
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P34931
HTS Code 3002150000
Gene ID 3305
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HSPA1L Antibody 100ul

Anti-HSPA1L Antibody 100ul