PPP1R11,HCG-V,HCGV
  • PPP1R11,HCG-V,HCGV

Anti-PPP1R11 Antibody 25ul

Ref: AN-HPA043266-25ul
Anti-PPP1R11

Información del producto

Polyclonal Antibody against Human PPP1R11, Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 11, Alternative Gene Names: HCG-V, HCGV, TCTE5, Tctex5, Validated applications: IHC, Uniprot ID: O60927, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPP1R11
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFG
Immunogen AGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HCG-V, HCGV, TCTE5, Tctex5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60927
HTS Code 3002150000
Gene ID 6992
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPP1R11 Antibody 25ul

Anti-PPP1R11 Antibody 25ul