PPP2CA,PP2Calpha
  • PPP2CA,PP2Calpha

Anti-PPP2CA Antibody 100ul

Ref: AN-HPA043236-100ul
Anti-PPP2CA

Información del producto

Polyclonal Antibody against Human PPP2CA, Gene description: protein phosphatase 2, catalytic subunit, alpha isozyme, Alternative Gene Names: PP2Calpha, Validated applications: IHC, WB, Uniprot ID: P67775, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPP2CA
Gene Description protein phosphatase 2, catalytic subunit, alpha isozyme
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
Immunogen RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PP2Calpha
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P67775
HTS Code 3002150000
Gene ID 5515
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPP2CA Antibody 100ul

Anti-PPP2CA Antibody 100ul