ST13,FAM10A1,HIP
  • ST13,FAM10A1,HIP

Anti-ST13 Antibody 100ul

Ref: AN-HPA043233-100ul
Anti-ST13

Información del producto

Polyclonal Antibody against Human ST13, Gene description: suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), Alternative Gene Names: FAM10A1, HIP, HSPABP1, P48, SNC6, Validated applications: ICC, IHC, Uniprot ID: P50502, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ST13
Gene Description suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEP
Immunogen KVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM10A1, HIP, HSPABP1, P48, SNC6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P50502
HTS Code 3002150000
Gene ID 6767
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ST13 Antibody 100ul

Anti-ST13 Antibody 100ul