SMC3,BAM,bamacan
  • SMC3,BAM,bamacan

Anti-SMC3 Antibody 100ul

Ref: AN-HPA043206-100ul
Anti-SMC3

Información del producto

Polyclonal Antibody against Human SMC3, Gene description: structural maintenance of chromosomes 3, Alternative Gene Names: BAM, bamacan, CSPG6, HCAP, SMC3L1, Validated applications: ICC, WB, Uniprot ID: Q9UQE7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SMC3
Gene Description structural maintenance of chromosomes 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence ALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQM
Immunogen ALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BAM, bamacan, CSPG6, HCAP, SMC3L1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UQE7
HTS Code 3002150000
Gene ID 9126
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SMC3 Antibody 100ul

Anti-SMC3 Antibody 100ul