NDUFA5,B13,CI-13kB
  • NDUFA5,B13,CI-13kB

Anti-NDUFA5 Antibody 100ul

Ref: AN-HPA043175-100ul
Anti-NDUFA5

Información del producto

Polyclonal Antibody against Human NDUFA5, Gene description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, Alternative Gene Names: B13, CI-13kB, CI-13KD-B, NUFM, UQOR13, Validated applications: IHC, WB, Uniprot ID: Q16718, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFA5
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence AMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Immunogen AMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B13, CI-13kB, CI-13KD-B, NUFM, UQOR13
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16718
HTS Code 3002150000
Gene ID 4698
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NDUFA5 Antibody 100ul

Anti-NDUFA5 Antibody 100ul