IRX1,IRX-5
  • IRX1,IRX-5

Anti-IRX1 Antibody 25ul

Ref: AN-HPA043160-25ul
Anti-IRX1

Información del producto

Polyclonal Antibody against Human IRX1, Gene description: iroquois homeobox 1, Alternative Gene Names: IRX-5, Validated applications: ICC, IHC, WB, Uniprot ID: P78414, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IRX1
Gene Description iroquois homeobox 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, ICC, WB
Sequence NKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS
Immunogen NKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IRX-5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78414
HTS Code 3002150000
Gene ID 79192
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IRX1 Antibody 25ul

Anti-IRX1 Antibody 25ul