INO80E,CCDC95
  • INO80E,CCDC95

Anti-INO80E Antibody 25ul

Ref: AN-HPA043146-25ul
Anti-INO80E

Información del producto

Polyclonal Antibody against Human INO80E, Gene description: INO80 complex subunit E, Alternative Gene Names: CCDC95, FLJ90652, Validated applications: ICC, IHC, WB, Uniprot ID: Q8NBZ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name INO80E
Gene Description INO80 complex subunit E
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDD
Immunogen LPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCDC95, FLJ90652
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NBZ0
HTS Code 3002150000
Gene ID 283899
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-INO80E Antibody 25ul

Anti-INO80E Antibody 25ul