RCN3,RLP49
  • RCN3,RLP49

Anti-RCN3 Antibody 100ul

Ref: AN-HPA043134-100ul
Anti-RCN3

Información del producto

Polyclonal Antibody against Human RCN3, Gene description: reticulocalbin 3, EF-hand calcium binding domain, Alternative Gene Names: RLP49, Validated applications: IHC, Uniprot ID: Q96D15, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RCN3
Gene Description reticulocalbin 3, EF-hand calcium binding domain
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYK
Immunogen DGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RLP49
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96D15
HTS Code 3002150000
Gene ID 57333
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RCN3 Antibody 100ul

Anti-RCN3 Antibody 100ul