MBD3L1,MBD3L
  • MBD3L1,MBD3L

Anti-MBD3L1 Antibody 25ul

Ref: AN-HPA043121-25ul
Anti-MBD3L1

Información del producto

Polyclonal Antibody against Human MBD3L1, Gene description: methyl-CpG binding domain protein 3-like 1, Alternative Gene Names: MBD3L, Validated applications: IHC, Uniprot ID: Q8WWY6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MBD3L1
Gene Description methyl-CpG binding domain protein 3-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAG
Immunogen MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MBD3L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WWY6
HTS Code 3002150000
Gene ID 85509
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MBD3L1 Antibody 25ul

Anti-MBD3L1 Antibody 25ul