MPV17L2,FKSG24
  • MPV17L2,FKSG24

Anti-MPV17L2 Antibody 100ul

Ref: AN-HPA043111-100ul
Anti-MPV17L2

Información del producto

Polyclonal Antibody against Human MPV17L2, Gene description: MPV17 mitochondrial membrane protein-like 2, Alternative Gene Names: FKSG24, MGC12972, Validated applications: IHC, WB, Uniprot ID: Q567V2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MPV17L2
Gene Description MPV17 mitochondrial membrane protein-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD
Immunogen GCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKSG24, MGC12972
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q567V2
HTS Code 3002150000
Gene ID 84769
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MPV17L2 Antibody 100ul

Anti-MPV17L2 Antibody 100ul