TNIP3,ABIN-3
  • TNIP3,ABIN-3

Anti-TNIP3 Antibody 100ul

Ref: AN-HPA043063-100ul
Anti-TNIP3

Información del producto

Polyclonal Antibody against Human TNIP3, Gene description: TNFAIP3 interacting protein 3, Alternative Gene Names: ABIN-3, FLJ21162, LIND, Validated applications: IHC, WB, Uniprot ID: Q96KP6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNIP3
Gene Description TNFAIP3 interacting protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEKEELQQINETSQSQLNR
Immunogen NKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEKEELQQINETSQSQLNR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABIN-3, FLJ21162, LIND
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96KP6
HTS Code 3002150000
Gene ID 79931
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TNIP3 Antibody 100ul

Anti-TNIP3 Antibody 100ul