DEFB119,DEFB-19
  • DEFB119,DEFB-19

Anti-DEFB119 Antibody 25ul

Ref: AN-HPA043059-25ul
Anti-DEFB119

Información del producto

Polyclonal Antibody against Human DEFB119, Gene description: defensin, beta 119, Alternative Gene Names: DEFB-19, DEFB-20, DEFB120, Validated applications: IHC, Uniprot ID: Q8N690, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DEFB119
Gene Description defensin, beta 119
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Immunogen KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DEFB-19, DEFB-20, DEFB120
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N690
HTS Code 3002150000
Gene ID 245932
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DEFB119 Antibody 25ul

Anti-DEFB119 Antibody 25ul