EDC4,Ge-1,HEDLS
  • EDC4,Ge-1,HEDLS

Anti-EDC4 Antibody 25ul

Ref: AN-HPA043038-25ul
Anti-EDC4

Información del producto

Polyclonal Antibody against Human EDC4, Gene description: enhancer of mRNA decapping 4, Alternative Gene Names: Ge-1, HEDLS, RCD-8, Validated applications: ICC, Uniprot ID: Q6P2E9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EDC4
Gene Description enhancer of mRNA decapping 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAP
Immunogen QRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Ge-1, HEDLS, RCD-8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P2E9
HTS Code 3002150000
Gene ID 23644
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EDC4 Antibody 25ul

Anti-EDC4 Antibody 25ul