B3GALT4,beta3Gal-T4
  • B3GALT4,beta3Gal-T4

Anti-B3GALT4 Antibody 100ul

Ref: AN-HPA043001-100ul
Anti-B3GALT4

Información del producto

Polyclonal Antibody against Human B3GALT4, Gene description: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4, Alternative Gene Names: beta3Gal-T4, GalT4, Validated applications: IHC, Uniprot ID: O96024, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name B3GALT4
Gene Description UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA
Immunogen PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names beta3Gal-T4, GalT4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O96024
HTS Code 3002150000
Gene ID 8705
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-B3GALT4 Antibody 100ul

Anti-B3GALT4 Antibody 100ul