SMG6,C17orf31,EST1A
  • SMG6,C17orf31,EST1A

Anti-SMG6 Antibody 100ul

Ref: AN-HPA042932-100ul
Anti-SMG6

Información del producto

Polyclonal Antibody against Human SMG6, Gene description: SMG6 nonsense mediated mRNA decay factor, Alternative Gene Names: C17orf31, EST1A, KIAA0732, SMG-6, Validated applications: ICC, IHC, Uniprot ID: Q86US8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SMG6
Gene Description SMG6 nonsense mediated mRNA decay factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLRNKPKIKEPPGSEEFKDEIVNDRDCSAVENGTQPVKDVCKELNNQEQNGPIDP
Immunogen MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLRNKPKIKEPPGSEEFKDEIVNDRDCSAVENGTQPVKDVCKELNNQEQNGPIDP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C17orf31, EST1A, KIAA0732, SMG-6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86US8
HTS Code 3002150000
Gene ID 23293
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SMG6 Antibody 100ul

Anti-SMG6 Antibody 100ul