CWH43,CWH43-C
  • CWH43,CWH43-C

Anti-CWH43 Antibody 100ul

Ref: AN-HPA042814-100ul
Anti-CWH43

Información del producto

Polyclonal Antibody against Human CWH43, Gene description: cell wall biogenesis 43 C-terminal homolog (S. cerevisiae), Alternative Gene Names: CWH43-C, FLJ21511, Validated applications: IHC, Uniprot ID: Q9H720, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CWH43
Gene Description cell wall biogenesis 43 C-terminal homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYF
Immunogen GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CWH43-C, FLJ21511
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H720
HTS Code 3002150000
Gene ID 80157
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CWH43 Antibody 100ul

Anti-CWH43 Antibody 100ul