HIGD2A,MGC2198
  • HIGD2A,MGC2198

Anti-HIGD2A Antibody 100ul

Ref: AN-HPA042715-100ul
Anti-HIGD2A

Información del producto

Polyclonal Antibody against Human HIGD2A, Gene description: HIG1 hypoxia inducible domain family, member 2A, Alternative Gene Names: MGC2198, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BW72, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HIGD2A
Gene Description HIG1 hypoxia inducible domain family, member 2A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN
Immunogen PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC2198
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BW72
HTS Code 3002150000
Gene ID 192286
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HIGD2A Antibody 100ul

Anti-HIGD2A Antibody 100ul