ARHGEF18,KIAA0521
  • ARHGEF18,KIAA0521

Anti-ARHGEF18 Antibody 100ul

Ref: AN-HPA042689-100ul
Anti-ARHGEF18

Información del producto

Polyclonal Antibody against Human ARHGEF18, Gene description: Rho/Rac guanine nucleotide exchange factor (GEF) 18, Alternative Gene Names: KIAA0521, MGC15913, P114-RhoGEF, Validated applications: ICC, IHC, Uniprot ID: Q6ZSZ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARHGEF18
Gene Description Rho/Rac guanine nucleotide exchange factor (GEF) 18
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI
Immunogen RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0521, MGC15913, P114-RhoGEF
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZSZ5
HTS Code 3002150000
Gene ID 23370
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARHGEF18 Antibody 100ul

Anti-ARHGEF18 Antibody 100ul