SAC3D1,HSU79266,SHD1
  • SAC3D1,HSU79266,SHD1

Anti-SAC3D1 Antibody 100ul

Ref: AN-HPA042677-100ul
Anti-SAC3D1

Información del producto

Polyclonal Antibody against Human SAC3D1, Gene description: SAC3 domain containing 1, Alternative Gene Names: HSU79266, SHD1, Validated applications: ICC, IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SAC3D1
Gene Description SAC3 domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AFREGNAARLFRLLQTLPYLPSCAVQCHVGHARREALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGEERVVFLRGRYVEEGLPPASTCKVLVE
Immunogen AFREGNAARLFRLLQTLPYLPSCAVQCHVGHARREALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGEERVVFLRGRYVEEGLPPASTCKVLVE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSU79266, SHD1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 29901
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SAC3D1 Antibody 100ul

Anti-SAC3D1 Antibody 100ul