DEFB118,C20orf63
  • DEFB118,C20orf63

Anti-DEFB118 Antibody 25ul

Ref: AN-HPA042634-25ul
Anti-DEFB118

Información del producto

Polyclonal Antibody against Human DEFB118, Gene description: defensin, beta 118, Alternative Gene Names: C20orf63, DEFB-18, dJ1018D12.3, ESC42, Validated applications: IHC, Uniprot ID: Q96PH6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DEFB118
Gene Description defensin, beta 118
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS
Immunogen KCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf63, DEFB-18, dJ1018D12.3, ESC42
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96PH6
HTS Code 3002150000
Gene ID 117285
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DEFB118 Antibody 25ul

Anti-DEFB118 Antibody 25ul