DENND1B,C1orf218
  • DENND1B,C1orf218

Anti-DENND1B Antibody 25ul

Ref: AN-HPA042586-25ul
Anti-DENND1B

Información del producto

Polyclonal Antibody against Human DENND1B, Gene description: DENN/MADD domain containing 1B, Alternative Gene Names: C1orf218, FAM31B, FLJ20054, MGC27044, Validated applications: ICC, IHC, Uniprot ID: Q6P3S1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DENND1B
Gene Description DENN/MADD domain containing 1B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence AFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTD
Immunogen AFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf218, FAM31B, FLJ20054, MGC27044
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P3S1
HTS Code 3002150000
Gene ID 163486
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DENND1B Antibody 25ul

Anti-DENND1B Antibody 25ul