CTB-50L17.10
  • CTB-50L17.10

Anti-CTB-50L17.10 Antibody 100ul

Ref: AN-HPA042559-100ul
Anti-CTB-50L17.10

Información del producto

Polyclonal Antibody against Human CTB-50L17.10, Gene description: Hepatoma-derived growth factor-related protein 2 , Validated applications: ICC, IHC, Uniprot ID: Q7Z4V5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CTB-50L17.10
Gene Description Hepatoma-derived growth factor-related protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK
Immunogen AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z4V5
HTS Code 3002150000
Gene ID 84717
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CTB-50L17.10 Antibody 100ul

Anti-CTB-50L17.10 Antibody 100ul