CACTIN,C19orf29
  • CACTIN,C19orf29

Anti-CACTIN Antibody 100ul

Ref: AN-HPA042548-100ul
Anti-CACTIN

Información del producto

Polyclonal Antibody against Human CACTIN, Gene description: cactin, spliceosome C complex subunit, Alternative Gene Names: C19orf29, cactin, fSAPc, NY-REN-24, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WUQ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CACTIN
Gene Description cactin, spliceosome C complex subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTG
Immunogen SLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C19orf29, cactin, fSAPc, NY-REN-24
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WUQ7
HTS Code 3002150000
Gene ID 58509
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CACTIN Antibody 100ul

Anti-CACTIN Antibody 100ul