SETD2,FLJ23184
  • SETD2,FLJ23184

Anti-SETD2 Antibody 100ul

Ref: AN-HPA042451-100ul
Anti-SETD2

Información del producto

Polyclonal Antibody against Human SETD2, Gene description: SET domain containing 2, Alternative Gene Names: FLJ23184, HIF-1, HYPB, KIAA1732, KMT3A, Validated applications: ICC, IHC, Uniprot ID: Q9BYW2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SETD2
Gene Description SET domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA
Immunogen NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ23184, HIF-1, HYPB, KIAA1732, KMT3A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYW2
HTS Code 3002150000
Gene ID 29072
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SETD2 Antibody 100ul

Anti-SETD2 Antibody 100ul