CLCF1,BSF-3,BSF3
  • CLCF1,BSF-3,BSF3

Anti-CLCF1 Antibody 25ul

Ref: AN-HPA042444-25ul
Anti-CLCF1

Información del producto

Polyclonal Antibody against Human CLCF1, Gene description: cardiotrophin-like cytokine factor 1, Alternative Gene Names: BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UBD9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CLCF1
Gene Description cardiotrophin-like cytokine factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE
Immunogen KTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBD9
HTS Code 3002150000
Gene ID 23529
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLCF1 Antibody 25ul

Anti-CLCF1 Antibody 25ul