IL17B,IL-17B,IL-20
  • IL17B,IL-17B,IL-20

Anti-IL17B Antibody 100ul

Ref: AN-HPA042441-100ul
Anti-IL17B

Información del producto

Polyclonal Antibody against Human IL17B, Gene description: interleukin 17B, Alternative Gene Names: IL-17B, IL-20, MGC138900, MGC138901, NIRF, ZCYTO7, Validated applications: IHC, WB, Uniprot ID: Q9UHF5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IL17B
Gene Description interleukin 17B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGY
Immunogen PRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IL-17B, IL-20, MGC138900, MGC138901, NIRF, ZCYTO7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UHF5
HTS Code 3002150000
Gene ID 27190
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IL17B Antibody 100ul

Anti-IL17B Antibody 100ul