MIEF2,MGC23130
  • MIEF2,MGC23130

Anti-MIEF2 Antibody 25ul

Ref: AN-HPA042334-25ul
Anti-MIEF2

Información del producto

Polyclonal Antibody against Human MIEF2, Gene description: mitochondrial elongation factor 2, Alternative Gene Names: MGC23130, MiD49, SMCR7, Validated applications: IHC, Uniprot ID: Q96C03, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MIEF2
Gene Description mitochondrial elongation factor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL
Immunogen PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC23130, MiD49, SMCR7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96C03
HTS Code 3002150000
Gene ID 125170
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MIEF2 Antibody 25ul

Anti-MIEF2 Antibody 25ul