BCAR1,CAS,CASS1
  • BCAR1,CAS,CASS1

Anti-BCAR1 Antibody 25ul

Ref: AN-HPA042282-25ul
Anti-BCAR1

Información del producto

Polyclonal Antibody against Human BCAR1, Gene description: breast cancer anti-estrogen resistance 1, Alternative Gene Names: CAS, CASS1, Crkas, P130Cas, Validated applications: IHC, WB, Uniprot ID: P56945, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BCAR1
Gene Description breast cancer anti-estrogen resistance 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, WB
Sequence SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYD
Immunogen SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAS, CASS1, Crkas, P130Cas
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P56945
HTS Code 3002150000
Gene ID 9564
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BCAR1 Antibody 25ul

Anti-BCAR1 Antibody 25ul