SEMA7A,CD108
  • SEMA7A,CD108

Anti-SEMA7A Antibody 100ul

Ref: AN-HPA042273-100ul
Anti-SEMA7A

Información del producto

Polyclonal Antibody against Human SEMA7A, Gene description: semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group), Alternative Gene Names: CD108, H-Sema-L, SEMAL, Validated applications: IHC, Uniprot ID: O75326, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SEMA7A
Gene Description semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGD
Immunogen QDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD108, H-Sema-L, SEMAL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75326
HTS Code 3002150000
Gene ID 8482
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SEMA7A Antibody 100ul

Anti-SEMA7A Antibody 100ul