B9D2,MGC4093,MKS10
  • B9D2,MGC4093,MKS10

Anti-B9D2 Antibody 25ul

Ref: AN-HPA042229-25ul
Anti-B9D2

Información del producto

Polyclonal Antibody against Human B9D2, Gene description: B9 protein domain 2, Alternative Gene Names: MGC4093, MKS10, Validated applications: WB, Uniprot ID: Q9BPU9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name B9D2
Gene Description B9 protein domain 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence WSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYG
Immunogen WSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC4093, MKS10
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BPU9
HTS Code 3002150000
Gene ID 80776
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-B9D2 Antibody 25ul

Anti-B9D2 Antibody 25ul