BCL2L10,BCL-B,Boo
  • BCL2L10,BCL-B,Boo

Anti-BCL2L10 Antibody 100ul

Ref: AN-HPA042222-100ul
Anti-BCL2L10

Información del producto

Polyclonal Antibody against Human BCL2L10, Gene description: BCL2-like 10 (apoptosis facilitator), Alternative Gene Names: BCL-B, Boo, Diva, Validated applications: IHC, Uniprot ID: Q9HD36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BCL2L10
Gene Description BCL2-like 10 (apoptosis facilitator)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MVDQLRERTTMADPLRERTELLLADYLGYCARE
Immunogen MVDQLRERTTMADPLRERTELLLADYLGYCARE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCL-B, Boo, Diva
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HD36
HTS Code 3002150000
Gene ID 10017
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BCL2L10 Antibody 100ul

Anti-BCL2L10 Antibody 100ul