GTPBP3,FLJ14700
  • GTPBP3,FLJ14700

Anti-GTPBP3 Antibody 100ul

Ref: AN-HPA042158-100ul
Anti-GTPBP3

Información del producto

Polyclonal Antibody against Human GTPBP3, Gene description: GTP binding protein 3 (mitochondrial), Alternative Gene Names: FLJ14700, GTPBG3, MSS1, MTGP1, THDF1, Validated applications: ICC, IHC, WB, Uniprot ID: Q969Y2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GTPBP3
Gene Description GTP binding protein 3 (mitochondrial)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence HALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNL
Immunogen HALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14700, GTPBG3, MSS1, MTGP1, THDF1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969Y2
HTS Code 3002150000
Gene ID 84705
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GTPBP3 Antibody 100ul

Anti-GTPBP3 Antibody 100ul