REXO1,EloA-BP1
  • REXO1,EloA-BP1

Anti-REXO1 Antibody 25ul

Ref: AN-HPA042155-25ul
Anti-REXO1

Información del producto

Polyclonal Antibody against Human REXO1, Gene description: REX1, RNA exonuclease 1 homolog (S. cerevisiae), Alternative Gene Names: EloA-BP1, KIAA1138, TCEB3BP1, Validated applications: IHC, Uniprot ID: Q8N1G1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name REXO1
Gene Description REX1, RNA exonuclease 1 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PSGKYVVDNSRPPTDLEYDPLSNYSARHLSRASSRDERAAKRPRGSRGSEPYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNEPTT
Immunogen PSGKYVVDNSRPPTDLEYDPLSNYSARHLSRASSRDERAAKRPRGSRGSEPYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNEPTT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EloA-BP1, KIAA1138, TCEB3BP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N1G1
HTS Code 3002150000
Gene ID 57455
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-REXO1 Antibody 25ul

Anti-REXO1 Antibody 25ul