FAHD2A,CGI-105
  • FAHD2A,CGI-105

Anti-FAHD2A Antibody 25ul

Ref: AN-HPA042145-25ul
Anti-FAHD2A

Información del producto

Polyclonal Antibody against Human FAHD2A, Gene description: fumarylacetoacetate hydrolase domain containing 2A, Alternative Gene Names: CGI-105, Validated applications: IHC, WB, Uniprot ID: Q96GK7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAHD2A
Gene Description fumarylacetoacetate hydrolase domain containing 2A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDW
Immunogen NYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-105
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96GK7
HTS Code 3002150000
Gene ID 51011
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAHD2A Antibody 25ul

Anti-FAHD2A Antibody 25ul