HSD17B8,D6S2245E
  • HSD17B8,D6S2245E

Anti-HSD17B8 Antibody 25ul

Ref: AN-HPA042132-25ul
Anti-HSD17B8

Información del producto

Polyclonal Antibody against Human HSD17B8, Gene description: hydroxysteroid (17-beta) dehydrogenase 8, Alternative Gene Names: D6S2245E, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1, Validated applications: IHC, WB, Uniprot ID: Q92506, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HSD17B8
Gene Description hydroxysteroid (17-beta) dehydrogenase 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
Immunogen GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D6S2245E, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92506
HTS Code 3002150000
Gene ID 7923
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HSD17B8 Antibody 25ul

Anti-HSD17B8 Antibody 25ul