PPP2R2B,PR52B
  • PPP2R2B,PR52B

Anti-PPP2R2B Antibody 100ul

Ref: AN-HPA042122-100ul
Anti-PPP2R2B

Información del producto

Polyclonal Antibody against Human PPP2R2B, Gene description: protein phosphatase 2, regulatory subunit B, beta, Alternative Gene Names: PR52B, PR55-BETA, SCA12, Validated applications: ICC, IHC, WB, Uniprot ID: Q00005, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPP2R2B
Gene Description protein phosphatase 2, regulatory subunit B, beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
Immunogen YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PR52B, PR55-BETA, SCA12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q00005
HTS Code 3002150000
Gene ID 5521
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPP2R2B Antibody 100ul

Anti-PPP2R2B Antibody 100ul