MRPS34,MGC2616
  • MRPS34,MGC2616

Anti-MRPS34 Antibody 100ul

Ref: AN-HPA042112-100ul
Anti-MRPS34

Información del producto

Polyclonal Antibody against Human MRPS34, Gene description: mitochondrial ribosomal protein S34, Alternative Gene Names: MGC2616, MRP-S12, Validated applications: ICC, IHC, WB, Uniprot ID: P82930, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPS34
Gene Description mitochondrial ribosomal protein S34
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT
Immunogen PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC2616, MRP-S12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P82930
HTS Code 3002150000
Gene ID 65993
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPS34 Antibody 100ul

Anti-MRPS34 Antibody 100ul