RPUSD2,C15orf19
  • RPUSD2,C15orf19

Anti-RPUSD2 Antibody 25ul

Ref: AN-HPA042079-25ul
Anti-RPUSD2

Información del producto

Polyclonal Antibody against Human RPUSD2, Gene description: RNA pseudouridylate synthase domain containing 2, Alternative Gene Names: C15orf19, C18B11, FLJ31409, Validated applications: ICC, IHC, Uniprot ID: Q8IZ73, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPUSD2
Gene Description RNA pseudouridylate synthase domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SGVLMFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEEVTCKEPILVVSYKVGVCRVDPRGKPCETVFQRLSYNGQSSV
Immunogen SGVLMFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEEVTCKEPILVVSYKVGVCRVDPRGKPCETVFQRLSYNGQSSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C15orf19, C18B11, FLJ31409
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IZ73
HTS Code 3002150000
Gene ID 27079
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPUSD2 Antibody 25ul

Anti-RPUSD2 Antibody 25ul