KNSTRN,C15orf23
  • KNSTRN,C15orf23

Anti-KNSTRN Antibody 25ul

Ref: AN-HPA042027-25ul
Anti-KNSTRN

Información del producto

Polyclonal Antibody against Human KNSTRN, Gene description: kinetochore-localized astrin/SPAG5 binding protein, Alternative Gene Names: C15orf23, FLJ14502, kinastrin, SKAP, TRAF4AF1, Validated applications: ICC, IHC, Uniprot ID: Q9Y448, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KNSTRN
Gene Description kinetochore-localized astrin/SPAG5 binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
Immunogen TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C15orf23, FLJ14502, kinastrin, SKAP, TRAF4AF1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y448
HTS Code 3002150000
Gene ID 90417
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KNSTRN Antibody 25ul

Anti-KNSTRN Antibody 25ul