FERMT1,C20orf42
  • FERMT1,C20orf42

Anti-FERMT1 Antibody 100ul

Ref: AN-HPA041966-100ul
Anti-FERMT1

Información del producto

Polyclonal Antibody against Human FERMT1, Gene description: fermitin family member 1, Alternative Gene Names: C20orf42, FLJ20116, KIND1, UNC112A, URP1, Validated applications: IHC, WB, Uniprot ID: Q9BQL6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FERMT1
Gene Description fermitin family member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL
Immunogen ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf42, FLJ20116, KIND1, UNC112A, URP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQL6
HTS Code 3002150000
Gene ID 55612
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FERMT1 Antibody 100ul

Anti-FERMT1 Antibody 100ul