RASGRF1,CDC25
  • RASGRF1,CDC25

Anti-RASGRF1 Antibody 25ul

Ref: AN-HPA041965-25ul
Anti-RASGRF1

Información del producto

Polyclonal Antibody against Human RASGRF1, Gene description: Ras protein-specific guanine nucleotide-releasing factor 1, Alternative Gene Names: CDC25, CDC25L, GNRP, GRF1, GRF55, H-GRF55, PP13187, Validated applications: ICC, IHC, Uniprot ID: Q13972, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RASGRF1
Gene Description Ras protein-specific guanine nucleotide-releasing factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTE
Immunogen RKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CDC25, CDC25L, GNRP, GRF1, GRF55, H-GRF55, PP13187
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13972
HTS Code 3002150000
Gene ID 5923
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RASGRF1 Antibody 25ul

Anti-RASGRF1 Antibody 25ul