TYROBP,DAP12,KARAP
  • TYROBP,DAP12,KARAP

Anti-TYROBP Antibody 100ul

Ref: AN-HPA041899-100ul
Anti-TYROBP

Información del producto

Polyclonal Antibody against Human TYROBP, Gene description: TYRO protein tyrosine kinase binding protein, Alternative Gene Names: DAP12, KARAP, PLO-SL, PLOSL, Validated applications: IHC, WB, Uniprot ID: O43914, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TYROBP
Gene Description TYRO protein tyrosine kinase binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
Immunogen FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DAP12, KARAP, PLO-SL, PLOSL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43914
HTS Code 3002150000
Gene ID 7305
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TYROBP Antibody 100ul

Anti-TYROBP Antibody 100ul