AP4E1,AP-4-EPSILON
  • AP4E1,AP-4-EPSILON

Anti-AP4E1 Antibody 25ul

Ref: AN-HPA041891-25ul
Anti-AP4E1

Información del producto

Polyclonal Antibody against Human AP4E1, Gene description: adaptor-related protein complex 4, epsilon 1 subunit, Alternative Gene Names: AP-4-EPSILON, SPG51, Validated applications: IHC, Uniprot ID: Q9UPM8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AP4E1
Gene Description adaptor-related protein complex 4, epsilon 1 subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AELNHNVTYAILFECVHTVYSIYPKSELLEKAAKCIGKFVLSPKINLKYLGLKALTYVIQQDPTLALQHQMTIIECLDHPDPIIKRETLELLYRITNAQNITV
Immunogen AELNHNVTYAILFECVHTVYSIYPKSELLEKAAKCIGKFVLSPKINLKYLGLKALTYVIQQDPTLALQHQMTIIECLDHPDPIIKRETLELLYRITNAQNITV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP-4-EPSILON, SPG51
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UPM8
HTS Code 3002150000
Gene ID 23431
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AP4E1 Antibody 25ul

Anti-AP4E1 Antibody 25ul