MAGEB6,CT3.4
  • MAGEB6,CT3.4

Anti-MAGEB6 Antibody 100ul

Ref: AN-HPA041853-100ul
Anti-MAGEB6

Información del producto

Polyclonal Antibody against Human MAGEB6, Gene description: melanoma antigen family B, 6, Alternative Gene Names: CT3.4, FLJ40242, MAGE-B6, MAGEB6A, Validated applications: IHC, Uniprot ID: Q8N7X4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAGEB6
Gene Description melanoma antigen family B, 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SVPQESQGASPTGSPDAGVSGSKYDVAANGQDEKSPSTSHDVSVPQESQGASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKK
Immunogen SVPQESQGASPTGSPDAGVSGSKYDVAANGQDEKSPSTSHDVSVPQESQGASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT3.4, FLJ40242, MAGE-B6, MAGEB6A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N7X4
HTS Code 3002150000
Gene ID 158809
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAGEB6 Antibody 100ul

Anti-MAGEB6 Antibody 100ul