PPP1R14D,CPI17-like
  • PPP1R14D,CPI17-like

Anti-PPP1R14D Antibody 100ul

Ref: AN-HPA041846-100ul
Anti-PPP1R14D

Información del producto

Polyclonal Antibody against Human PPP1R14D, Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 14D, Alternative Gene Names: CPI17-like, FLJ20251, GBPI-1, MGC119014, MGC119016, Validated applications: IHC, WB, Uniprot ID: Q9NXH3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPP1R14D
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 14D
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCP
Immunogen ENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CPI17-like, FLJ20251, GBPI-1, MGC119014, MGC119016
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NXH3
HTS Code 3002150000
Gene ID 54866
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPP1R14D Antibody 100ul

Anti-PPP1R14D Antibody 100ul