CLC,Gal-10,LGALS10
  • CLC,Gal-10,LGALS10

Anti-CLC Antibody 100ul

Ref: AN-HPA041751-100ul
Anti-CLC

Información del producto

Polyclonal Antibody against Human CLC, Gene description: Charcot-Leyden crystal galectin, Alternative Gene Names: Gal-10, LGALS10, MGC149659, Validated applications: IHC, WB, Uniprot ID: Q05315, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CLC
Gene Description Charcot-Leyden crystal galectin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM
Immunogen LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Gal-10, LGALS10, MGC149659
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q05315
HTS Code 3002150000
Gene ID 1178
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLC Antibody 100ul

Anti-CLC Antibody 100ul